Support Exporting Model and Partition Selections to MrBayes

.gitignore

@@ -14,6 +14,7 @@ tags
 test_scripts/iqtree_test_cmds.txt
 pllrepo/
 build/
+cmake-build-debug/
 /Default-clang
 .idea/
 .idea/codeStyleSettings.xml

alignment/alignment.cpp

@@ -23,6 +23,7 @@
 
 #include <Eigen/LU>
 #ifdef USE_BOOST
+#include <boost/bimap.hpp>
 #include <boost/math/distributions/binomial.hpp>
 #endif
 
@@ -62,6 +63,8 @@ char genetic_code23[] = "KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSS
 char genetic_code24[] = "KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF"; // Pterobranchia mitochondrial
 char genetic_code25[] = "KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF"; // Candidate Division SR1 and Gracilibacteria
 
+boost::bimap<int, char*> genetic_code_map;
+
 Alignment::Alignment()
         : vector<Pattern>()
 {
@@ -1892,7 +1895,32 @@ void Alignment::convertStateStr(string &str, SeqType seq_type) {
         (*it) = convertState(*it, seq_type);
 }
 */
-
+
+boost::bimap<int, char*> getGeneticCodeMap() {
+    if (!genetic_code_map.empty()) return genetic_code_map;
+
+    genetic_code_map.insert({1, genetic_code1});
+    genetic_code_map.insert({2, genetic_code2});
+    genetic_code_map.insert({3, genetic_code3});
+    genetic_code_map.insert({4, genetic_code4});
+    genetic_code_map.insert({5, genetic_code5});
+    genetic_code_map.insert({6, genetic_code6});
+    genetic_code_map.insert({9, genetic_code9});
+    genetic_code_map.insert({10, genetic_code10});
+    genetic_code_map.insert({11, genetic_code11});
+    genetic_code_map.insert({12, genetic_code12});
+    genetic_code_map.insert({13, genetic_code13});
+    genetic_code_map.insert({14, genetic_code14});
+    genetic_code_map.insert({16, genetic_code16});
+    genetic_code_map.insert({21, genetic_code21});
+    genetic_code_map.insert({22, genetic_code22});
+    genetic_code_map.insert({23, genetic_code23});
+    genetic_code_map.insert({24, genetic_code24});
+    genetic_code_map.insert({25, genetic_code25});
+
+    return genetic_code_map;
+}
+
 void Alignment::initCodon(char *gene_code_id) {
     // build index from 64 codons to non-stop codons
 	int transl_table = 1;
@@ -1902,30 +1930,13 @@ void Alignment::initCodon(char *gene_code_id) {
 		} catch (string &str) {
 			outError("Wrong genetic code ", gene_code_id);
 		}
-		switch (transl_table) {
-		case 1: genetic_code = genetic_code1; break;
-		case 2: genetic_code = genetic_code2; break;
-		case 3: genetic_code = genetic_code3; break;
-		case 4: genetic_code = genetic_code4; break;
-		case 5: genetic_code = genetic_code5; break;
-		case 6: genetic_code = genetic_code6; break;
-		case 9: genetic_code = genetic_code9; break;
-		case 10: genetic_code = genetic_code10; break;
-		case 11: genetic_code = genetic_code11; break;
-		case 12: genetic_code = genetic_code12; break;
-		case 13: genetic_code = genetic_code13; break;
-		case 14: genetic_code = genetic_code14; break;
-		case 15: genetic_code = genetic_code15; break;
-		case 16: genetic_code = genetic_code16; break;
-		case 21: genetic_code = genetic_code21; break;
-		case 22: genetic_code = genetic_code22; break;
-		case 23: genetic_code = genetic_code23; break;
-		case 24: genetic_code = genetic_code24; break;
-		case 25: genetic_code = genetic_code25; break;
-		default:
+		auto code_map = getGeneticCodeMap();
+		auto found = code_map.left.find(transl_table);
+		if (found == code_map.left.end()) {
 			outError("Wrong genetic code ", gene_code_id);
-			break;
+			return;
 		}
+		genetic_code = found->second;
 	} else {
 		genetic_code = genetic_code1;
 	}
@@ -1958,6 +1969,15 @@ void Alignment::initCodon(char *gene_code_id) {
 //	cout << "num_states = " << num_states << endl;
 }
 
+int Alignment::getGeneticCodeId() {
+    if (seq_type != SEQ_CODON || genetic_code == nullptr) return 0;
+
+    auto code_map = getGeneticCodeMap();
+    auto found = code_map.right.find(genetic_code);
+    if (found == code_map.right.end()) return 0;
+    return found->second;
+}
+
 int getMorphStates(StrVector &sequences) {
 	char maxstate = 0;
 	for (StrVector::iterator it = sequences.begin(); it != sequences.end(); it++)

alignment/alignment.h

@@ -1059,6 +1059,12 @@ class Alignment : public vector<Pattern>, public CharSet, public StateSpace {
      */
     void extractMapleFile(const std::string& aln_name, const InputType& format);
 
+    /**
+     * Get the numerical id of the genetic code
+     * @return id the genetic code id, or 0 if not a codon type
+     */
+    int getGeneticCodeId();
+
 protected:
 
 

main/phyloanalysis.cpp

@@ -1330,6 +1330,10 @@ void printOutfilesInfo(Params &params, IQTree &tree) {
     if (params.optimize_linked_gtr) {
         cout << "  GTRPMIX nex file:              " << params.out_prefix << ".GTRPMIX.nex" << endl;
     }
+
+    if (params.mr_bayes_output) {
+        cout << "  MrBayes block written to:      " <<  params.out_prefix << ".mr_bayes.nex" << endl;
+    }
     cout << endl;
 
 }
@@ -3303,6 +3307,91 @@ SuperNeighbor* findRootedNeighbour(SuperNeighbor* super_root, int part_id) {
     return nullptr;
 }
 
+void printMrBayesBlockFile(Params &params, IQTree* &iqtree) {
+    ofstream out;
+    string filename = string(params.out_prefix) + ".mr_bayes.nex";
+    try {
+        out.exceptions(ios::failbit | ios::badbit);
+        out.open(filename);
+
+        // Write Warning
+        out << "#nexus" << endl << endl
+            <<"[This MrBayes Block Declaration provides the basic "
+            << (iqtree->isSuperTree() ? "partition structure and models" : "models")
+            << " from the IQTree Run.]" << endl
+            << "[Note that MrBayes does not support a large collection of models, so defaults of 'nst=6' for DNA and 'wag' for Protein will be used if a model that does not exist in MrBayes is used.]" << endl
+            << "[Furthermore, the Model Parameter '+R' will be replaced by '+G+I'.]" << endl
+            << "[This should be used as a Template Only.]" << endl << endl;
+
+        // Begin File, Print Charsets
+        out << "begin mrbayes;" << endl;
+    } catch (ios::failure &) {
+        outError(ERR_WRITE_OUTPUT, filename);
+    }
+
+    if (!iqtree->isSuperTree()) {
+        out << "  [IQTree inferred model " << iqtree->getModelName() << ", ";
+        iqtree->getModel()->printMrBayesModelText(out, "all", "");
+
+        out << endl << "end;" << endl;
+        out.close();
+        return;
+    }
+
+    auto stree = (PhyloSuperTree*) iqtree;
+    auto saln = (SuperAlignment*) stree->aln;
+    auto size = stree->size();
+
+    for (int part = 0; part < size; part++) {
+        string name = saln->partitions[part]->name;
+        replace(name.begin(), name.end(), '+', '_');
+        out << "  charset " << name << " = ";
+
+        string pos = saln->partitions[part]->position_spec;
+        replace(pos.begin(), pos.end(), ',' , ' ');
+        out << pos << ";" << endl;
+    }
+
+    // Create Partition
+    out << endl << "  partition iqtree = " << size << ": ";
+    for (int part = 0; part < size; part++) {
+        if (part != 0) out << ", ";
+
+        string name = saln->partitions[part]->name;
+        replace(name.begin(), name.end(), '+', '_');
+        out << name;
+    }
+    out << ";" << endl;
+
+    // Set Partition for Use
+    out << "  set partition = iqtree;" << endl << endl;
+
+    // Partition-Specific Model Information
+    for (int part = 0; part < size; part++) {
+        PhyloTree* curr_tree = stree->at(part);
+
+        out << "  [Subset #" << part + 1 << ": IQTree inferred model " << curr_tree->getModelName() << ", ";
+        curr_tree->getModel()->printMrBayesModelText(out,
+                                                     convertIntToString(part + 1),
+                                                     saln->partitions[part]->name);
+        out << endl;
+    }
+
+    // Partition Type Settings
+    if (params.partition_type != TOPO_UNLINKED) {
+        out << "unlink statefreq=(all) revmat=(all) shape=(all) pinvar=(all) tratio=(all);" << endl;
+        if (params.partition_type != BRLEN_FIX) {
+            out << "prset applyto=(all) ratepr=variable;" << endl;
+            if (params.partition_type != BRLEN_SCALE) {
+                out << "unlink brlens=(all);" << endl;
+            }
+        }
+    }
+
+    out << "end;" << endl;
+    out.close();
+}
+
 /************************************************************
  *  MAIN TREE RECONSTRUCTION
  ***********************************************************/
@@ -3820,8 +3909,14 @@ void runTreeReconstruction(Params &params, IQTree* &iqtree) {
 
     }
     if (iqtree->isSuperTree()) {
-        ((PhyloSuperTree*) iqtree)->computeBranchLengths();
-        ((PhyloSuperTree*) iqtree)->printBestPartitionParams((string(params.out_prefix) + ".best_model.nex").c_str());
+        auto stree = (PhyloSuperTree*) iqtree;
+        stree->computeBranchLengths();
+        stree->printBestPartitionParams((string(params.out_prefix) + ".best_model.nex").c_str());
+    }
+    if (params.mr_bayes_output) {
+        cout << endl << "Writing MrBayes Block Files..." << endl;
+        printMrBayesBlockFile(params, iqtree);
+        cout << endl;
     }
 
     cout << "BEST SCORE FOUND : " << iqtree->getCurScore() << endl;

main/phylotesting.h

@@ -811,6 +811,13 @@ string convertSeqTypeToSeqTypeName(SeqType seq_type);
 
 string detectSeqTypeName(string model_name);
 
+/**
+ * get string name from a SeqType object
+ * @param seq_type input sequence type
+ * @return name
+ */
+string getSeqTypeName(SeqType seq_type);
+
 /****************************************************/
 /*    Q MATRICES NESTING CHECK                      */
 /****************************************************/

model/modelbin.cpp

@@ -76,3 +76,31 @@ string ModelBIN::getNameParams(bool show_fixed_params) {
     }
     return retname.str();
 }
+
+void ModelBIN::printMrBayesModelText(ofstream& out, string partition, string charset) {
+    RateHeterogeneity* rate = phylo_tree->getRate();
+    bool equal_freq = freq_type == FREQ_EQUAL;
+
+    // Free Rate should be substituted by +G (+I not supported)
+    bool has_gamma = rate->getGammaShape() != 0.0 || rate->isFreeRate();
+
+    // MrBayes's Binary Model is 'F81-like'.
+    out << "using MrBayes model F81" << (has_gamma ? "+G" : "") << (equal_freq ? "+FQ" : "") << "]" << endl;
+    if (rate->isFreeRate() || rate->getPInvar() > 0.0) {
+        out << "  [+I modifier ignored, not supported by MrBayes for binary data]" << endl;
+        outWarning("MrBayes does not support Invariable Sites with Binary Data! +I has been ignored!");
+    }
+
+    // Lset Parameters
+    out << "  lset applyto=(" << partition << ") rates=";
+    if (has_gamma) {
+        // Rate Categories + Gamma
+        out << "gamma";
+    } else
+        out << "equal";
+
+    out << ";" << endl;
+
+    if (equal_freq)
+        out << "  prset applyto=(" << partition << ") statefreqpr=fixed(equal);" << endl;
+}

model/modelbin.h

@@ -55,6 +55,14 @@ class ModelBIN : public ModelMarkov
     */
     virtual void startCheckpoint();
 
+    /**
+     * Print the model information in a format that can be accepted by MrBayes, using lset and prset.<br>
+     * By default, it simply prints a warning to the log and to the stream, stating that this model is not supported by MrBayes.
+     * @param out the ofstream to print the result to
+     * @param partition the partition to apply lset and prset to
+     * @param charset the current partition's charset.
+     */
+    virtual void printMrBayesModelText(ofstream& out, string partition, string charset);
 };
 
 #endif

model/modelcodon.cpp

@@ -1182,6 +1182,41 @@ double ModelCodon::optimizeParameters(double gradient_epsilon) {
 	return score;
 }
 
+void ModelCodon::printMrBayesModelText(ofstream& out, string partition, string charset) {
+    // NST should be 1 if fix_kappa is true (no ts/tv ratio), else it should be 2
+    // GTR codon is not available in IQTREE
+    int nst = fix_kappa ? 1 : 2;
+    int code = phylo_tree->aln->getGeneticCodeId();
+    string mr_bayes_code = getMrBayesGeneticCode(code);
+    bool code_not_supported = mr_bayes_code.empty();
+    RateHeterogeneity* rate = phylo_tree->getRate();
+
+    string model_name = fix_kappa ? "JC" : "HKY";
+
+    // If this model is a Empirical / Semi-Empirical Model
+    if (num_params == 0 || name.find('_') != string::npos) {
+        nst = 6;
+        model_name = "GTR";
+    }
+
+    out << "using MrBayes model " << model_name << "]" << endl;
+
+    if (rate->isFreeRate() || rate->getGammaShape() > 0.0 || rate->getPInvar() > 0.0) {
+        out << "  [Rate modifiers (+I, +G, +R) ignored, not supported by MrBayes codon models]" << endl;
+        outWarning("MrBayes Codon Models do not support any Heterogenity Rate Modifiers! (+I, +G, +R) They have been ignored!");
+    }
+
+    if (code_not_supported) {
+        outWarning("MrBayes Does Not Support Codon Code " + convertIntToString(code) + "! Defaulting to Universal (Code 1).");
+        mr_bayes_code = "universal";
+    }
+
+    out << "  [IQTree genetic code " << code << ", using MrBayes genetic code " << mr_bayes_code << "]" << endl;
+    if (code_not_supported)
+        out << "  [Genetic code " << code << " is not supported by MrBayes, defaulting to universal (code 1)]" << endl;
+
+    out << "  lset applyto=(" << partition << ") nucmodel=codon omegavar=equal nst=" << nst << " code=" << mr_bayes_code << ";" << endl;
+}
 
 void ModelCodon::writeInfo(ostream &out) {
     if (name.find('_') == string::npos)

model/modelcodon.h

@@ -222,6 +222,15 @@ class ModelCodon: public ModelMarkov {
 	*/
 	virtual bool getVariables(double *variables);
 
+    /**
+     * Print the model information in a format that can be accepted by MrBayes, using lset and prset.<br>
+     * By default, it simply prints a warning to the log and to the stream, stating that this model is not supported by MrBayes.
+     * @param out the ofstream to print the result to
+     * @param partition the partition to apply lset and prset to
+     * @param charset the current partition's charset.
+     */
+    virtual void printMrBayesModelText(ofstream& out, string partition, string charset);
+
 };
 
 #endif /* MODELCODON_H_ */