Skip to content

Huge differences between DeepFRI server and local predictions #18

Open
@OtimusOne

Description

@OtimusOne

Hello, I am using a local instance of DeepFRI with the Newest Models(CPU) and I've noticed that the predictions I get are totally different when compared with the server.

For example for the 1S3P sequence the server returns a total of 12 predictions with a score over 0.50 while my local instance returns none. I'm running in a Windows Subsystem for Linux environment without GPU but I don't think that should be an issue for the CPU models?

$ python ./predict.py --seq 'SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKDGFIDEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES' -ont mf --verbose
2022-03-21 22:37:37.026507: W tensorflow/stream_executor/platform/default/dso_loader.cc:59] Could not load dynamic library 'libcudart.so.10.1'; dlerror: libcudart.so.10.1: cannot open shared object file: No such file or directory
2022-03-21 22:37:37.026573: I tensorflow/stream_executor/cuda/cudart_stub.cc:29] Ignore above cudart dlerror if you do not have a GPU set up on your machine.
2022-03-21 22:37:38.620674: W tensorflow/stream_executor/platform/default/dso_loader.cc:59] Could not load dynamic library 'libcuda.so.1'; dlerror: libcuda.so.1: cannot open shared object file: No such file or directory
2022-03-21 22:37:38.620760: W tensorflow/stream_executor/cuda/cuda_driver.cc:312] failed call to cuInit: UNKNOWN ERROR (303)
2022-03-21 22:37:38.620818: I tensorflow/stream_executor/cuda/cuda_diagnostics.cc:156] kernel driver does not appear to be running on this host: /proc/driver/nvidia/version does not exist
2022-03-21 22:37:38.621137: I tensorflow/core/platform/cpu_feature_guard.cc:142] This TensorFlow binary is optimized with oneAPI Deep Neural Network Library (oneDNN)to use the following CPU instructions in performance-critical operations:  AVX2 FMA
To enable them in other operations, rebuild TensorFlow with the appropriate compiler flags.
2022-03-21 22:37:38.635260: I tensorflow/core/platform/profile_utils/cpu_utils.cc:104] CPU Frequency: 4001000000 Hz
2022-03-21 22:37:38.637696: I tensorflow/compiler/xla/service/service.cc:168] XLA service 0x7ffffa70a150 initialized for platform Host (this does not guarantee that XLA will be used). Devices:
2022-03-21 22:37:38.637795: I tensorflow/compiler/xla/service/service.cc:176]   StreamExecutor device (0): Host, Default Version
### Computing predictions on a single protein...
Protein GO-term/EC-number Score GO-term/EC-number name
query_prot GO:0005509 0.13736 calcium ion binding
query_prot GO:0016788 0.11856 hydrolase activity, acting on ester bonds
### Saving predictions to *.json file...

Metadata

Metadata

Assignees

No one assigned

    Labels

    No labels
    No labels

    Type

    No type

    Projects

    No projects

    Milestone

    No milestone

    Relationships

    None yet

    Development

    No branches or pull requests

    Issue actions