config.txt

[PROCESS]
folding_steps = 5000

[SEQUENCE]
sequence = MGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRSHVWGECPVLPALLSGVRALSESHQKRLRKDSRDDDGDDGDGDNDNDDGDGDDDDGDDDGDNDNDDDDGDGDDDGDGDDDRDDSDGGGGDHADDDNGNDDGDDDGHPETLEKFDKFKHLKTADEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIHVLQSKHPGDFGADAQAAMNKALELFRNDMAAKYKELGFQG

[optional]

#this structure is not compatible with the sequence above, so if use_structure is set to TRUE it will not work. Change the sequence/structure is you want to include the structure in the input.

structure = [[0,0],[0,1],[1,1],[1,2],[1,3],[2,3],[2,2],[2,1],[2,0],[2,-1],[1,-1],[0,-1],[-1,-1],[-1,-2],[-1,-3],[-1,-4],[-1,-5],[-1,-6],[-1,-7],[-1,-8],[-2,-8],[-3,-8],[-3,-8],[-4,-8],[-5,-8],[-5,-7],[-5,-6],[-5,-4],[-5,-3],[-6,-3]]
use_structure = FALSE

annealing = TRUE
T = 2.0

create_gif = TRUE

[random_seed]

# if is you don't want to indicate a specific seed insert 'seed = None' and a random one will be taken (it will be printed when the simulation starts)

seed = 123